PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010556641.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 727aa    MW: 79357.7 Da    PI: 5.7916
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010556641.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.7e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE++++++a +++G   W +I +++g ++t+ q++s+ qk+
   XP_010556641.1 24 RERWTEEEHDRFLEALRLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.72E-171874IPR009057Homeodomain-like
PROSITE profilePS5129420.0961973IPR017930Myb domain
TIGRFAMsTIGR015572.4E-172271IPR006447Myb domain, plants
SMARTSM007171.5E-122371IPR001005SANT/Myb domain
PfamPF002492.3E-132467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-82464IPR009057Homeodomain-like
CDDcd001672.70E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
METNTSGEEL VTKTRKPYTI TKQRERWTEE EHDRFLEALR LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KLEKEAQAKG IPVCQALDIE IPPPRPKRKP ITPYPRKPGN GTSTSQVSSA  120
KDGKIALSAS SSHCNQALDL EKEPLTEPDG VEKISNGKEN QDDNCSGVST RPPEAHCSSI  180
SSVNKYPLAN KMAPKDPNTF RESEPSLRKA AADNGTSKTS NADNSCYSQD NAAKDLPHVN  240
LGREDNDVNG LPLADNMYDI QNYPWRFPVH VQNGGIGTCP QEFMFRPNGE FHGHSGLFTV  300
PATSASSQHQ DNMHRSSHQA FSAFVPACHT QDDYRSFIQI SSTLSNLIVS ALLQNPAAHA  360
AATYAASFWP YANVGSSNDS STSTIQTDGA FPLSQMSSPP NMAVIAAATV AAATAWWAAH  420
GLLPICAPFA CSPMSATTDP PPSSAQTAMP ETDKKEAATE NTQEPAMEPS DALEVQNLAS  480
KSPASSSDDS EEIGRNKKEA GSKADDHKEE AVAAVQEQVV NSNTTQKKKM VDPSSCGSNT  540
PSGSDVETDA LEKAEKDKEE DVKETEGNEP ATESSNRRAR SKDNSSDSWK EVSEEGRMAF  600
EALFARGRLP QSFSPPIDVE KLKESSEKEK INLDGKEREM WVQMDHKSKT QESICKGKDE  660
KSIAAAKDEK EVVIGNGKSI IKTRRTGFKP YKRCSMEAKE SRVANISSSQ AEENASKRLR  720
LEGEAST
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010556646.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_010556645.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_010556644.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_010556642.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_010556641.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_010556640.10.0PREDICTED: protein LHY-like isoform X1
SwissprotQ6R0H10.0LHY_ARATH; Protein LHY
TrEMBLA0A076L4N20.0A0A076L4N2_9R
STRINGAT1G01060.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-179MYB_related family protein